HORDB

ID: hor006779
Uniprot ID: Q9GK30
Protein name: Parathyroid hormone-related protein
Gene name: PTHLH
Organism: Ovis aries (Sheep)
Family: Parathyroid hormone family
Source: Animal
Expression: NA
Disease: NA
Comments: NA
Taxonomy: Ovis (genus), Caprinae (subfamily), Bovidae (family), Pecora (infraorder), Ruminantia (suborder), Artiodactyla (order), Laurasiatheria (superorder), Boreoeutheria , Eutheria , Theria , Mammalia (class), Amniota , Tetrapoda , Dipnotetrapodomorpha , Sarcopterygii (superclass), Euteleostomi , Teleostomi , Gnathostomata , Vertebrata , Craniata (subphylum), Chordata (phylum), Deuterostomia , Bilateria , Eumetazoa , Metazoa (kingdom), Opisthokonta , Eukaryota (superkingdom),cellular organisms
GO MF: GO:0005179 hormone activity; GO:0051428 peptide hormone receptor binding
GO BP: GO:0007165 signal transduction; GO:0030282 bone mineralization
GO CC: GO:0005576 extracellular region; GO:0005634 nucleus; GO:0005737 cytoplasm

Sequence: AVSEHQLLHDKGKSIQDLRRRFFLHHLIAEIHTAEIRATSEVSPNSKPAPNTKNHPVRFGSDDEGKYLTQETNKVETYKEQPLKTPGKKKKGKPG
Length: 95(27-121)
Propeptide: VGVFLLSYSVPSCGRSVEELGRRLKRAVSEHQLLHDKGKSIQDLRRRFFLHHLIAEIHTAEIRATSEVSPNSKPAPNTKNHPVRFGSDDEGKYLTQETNKVETYKEQPLKTPGKKKKGKPG
Signal peptide: VGVFLLSYSVPSCG
Modification: NA
Glycosylation: NA
Mutagenesis: NA

Function: Neuroendocrine peptide which is a critical regulator of cellular and organ growth, development, migration, differentiation and survival and of epithelial calcium ion transport. Regulates endochondral bone development and epithelial-mesenchymal interaction
Mechanism: NA
Cross BBB: NA
Target: PTH1R
Target Unid: W5P9K8
IC50: NA
EC50: NA
ED50: NA
kd: NA
Half life: NA

Structure: (PDB_ID-from https://www.rcsb.org/; AlphaFold_DB_ID-from https://alphafold.ebi.ac.uk/; hordbxxxxxx_AF2.pdb was predicted structure by AlphaFold2; hordbxxxxxx_ESM.pdb was predicted structure by ESMFold)

hor006779_AF2.pdb

hor006779_ESM.pdb

Mass:	1244399	Formula:	C475H765N143O143
Absent amino acids:	CMW	Common amino acids:	K
pI:	10.39	Basic residues:	24
Polar residues:	25	Hydrophobic residues:	23
Hydrophobicity:	-115.26	Boman Index:	-25755
Half-Life:	4.4 hour	Half-Life Yeast:	>20 hour
Half-Life E.Coli:	>10 hour	Aliphatic Index	62.63
Instability Index:	3981.37	Extinction Coefficient cystines:	2980
Absorbance 280nm:	31.7